I'm trying to take a file INPUT and, if a line in that file contains a string, replace the line with something else (the entire line, including line breaks), or nothing at all (remove the line like it wasn't there). Writing all this to a new file .
Here's that section of code...
while(<INPUT>){
if ($_ =~ / <openTag>/){
chomp;
print OUTPUT "Some_Replacement_String";
} elsif ($_ =~ / <\/closeTag>/) {
chomp;
print OUTPUT ""; #remove the line
} else {
chomp;
print OUTPUT "$_\r\n"; #print the original line
}
}
while(<INPUT>) should read one line at a time (if my understanding is correct) and store each line in the special variable $_
However, when I run the above code I get only the very first if statement condition returned Some_Replacement_String, and only once. (1 line, out of a file with 1.3m, and expecting 600,000 replacements). This obviously isn't the behavior I expect. If I do something like while(<INPUT>){print OUTPUT $_;) I get a copy of the entire file, every line, so I know the entire file is being read (expected behavior).
What I'm trying to do is get a line, test it, do something with it, and move on to the next one.
If it helps with troubleshooting at all, if I use print $.; anywhere in that while statement (or after it), I get 1 returned. I expected this to be the "Current line number for the last filehandle accessed.". So by the time my while statement loops through the entire file, it should be equal to the number of lines in the file, not 1.
I've tried a few other variations of this code, but I think this is the closest I've come. I assume there's a good reason I'm not getting the behavior I expect, can anyone tell me what it is?
The problem you are describing indicates that your input file only contains one line. This may be because of a great many different things, such as:
You have changed the input record separator $/
Your input file does not contain the correct line endings
You are running your script with -0777 switch
Some notes on your code:
if ($_ =~ / <openTag>/){
chomp;
print OUTPUT "Some_Replacement_String";
No need to chomp a line you are not using.
} elsif ($_ =~ / <\/closeTag>/) {
chomp;
print OUTPUT "";
This is quite redundant. You don't need to print an empty string (ever, really), and chomp a value you're not using.
} else {
chomp;
print OUTPUT "$_\r\n"; #print the original line
No need to remove newlines and then put them back. Also, normally you would use \n as your line ending, even on windows.
And, since you are chomping in every if-else clause, you might as well move that outside the entire if-block.
chomp;
if (....) {
But since you are never relying on line endings not being there, why bother using chomp at all?
When using the $_ variable, you can abbreviate some commands, such as you are doing with chomp. For example, a lone regex will be applied to $_:
} elsif (/ <\/closeTag>/) { # works splendidly
When, like above, you have a regex that contains slashes, you can choose another delimiter for your regex, so that you do not need to escape the slashes:
} elsif (m# </closeTag>#) {
But then you need to use the full notation of the m// operator, with the m in front.
So, in short
while(<INPUT>){
if (/ <openTag>/){
print OUTPUT "Some_Replacement_String";
} elsif (m# </closeTag>#) {
# do nothing
} else {
print OUTPUT $_; # print the original line
}
}
And of course, the last two can be combined into one, with some negation logic:
} elsif (not m# </closeTag>#) {
print OUTPUT $_;
}
Related
I have a uniprot document with a protein sequence as well as some metadata. I need to use perl to match the sequence and print it out but for some reason the last line always comes out two times. The code I wrote is here
#!usr/bin/perl
open (IN,'P30988.txt');
while (<IN>) {
if($_=~m /^\s+(\D+)/) { #this is the pattern I used to match the sequence in the document
$seq=$1;
$seq=~s/\s//g;} #removing the spaces from the sequence
print $seq;
}
I instead tried $seq.=$1; but it printed out the sequence 4.5 times. Im sure i have made a mistake here but not sure what. Here is the input file https://www.uniprot.org/uniprot/P30988.txt
Here is your code reformatted and extra whitespace added between operators to make it clearer what scope the statements are running in.
#!usr/bin/perl
open (IN,'P30988.txt');
while (<IN>) {
if ($_ =~ m /^\s+(\D+)/) {
$seq = $1;
$seq =~ s/\s//g;
}
print $seq;
}
The placement of the print command means that $seq will be printed for every line from the input file -- even those that don't match the regex.
I suspect you want this
#!usr/bin/perl
open (IN,'P30988.txt');
while (<IN>) {
if ($_ =~ m /^\s+(\D+)/) {
$seq = $1;
$seq =~ s/\s//g;
# only print $seq for lines that match with /^\s+(\D+)/
# Also - added a newline to make it easier to debug
print $seq . "\n";
}
}
When I run that I get this
MRFTFTSRCLALFLLLNHPTPILPAFSNQTYPTIEPKPFLYVVGRKKMMDAQYKCYDRMQ
QLPAYQGEGPYCNRTWDGWLCWDDTPAGVLSYQFCPDYFPDFDPSEKVTKYCDEKGVWFK
HPENNRTWSNYTMCNAFTPEKLKNAYVLYYLAIVGHSLSIFTLVISLGIFVFFRSLGCQR
VTLHKNMFLTYILNSMIIIIHLVEVVPNGELVRRDPVSCKILHFFHQYMMACNYFWMLCE
GIYLHTLIVVAVFTEKQRLRWYYLLGWGFPLVPTTIHAITRAVYFNDNCWLSVETHLLYI
IHGPVMAALVVNFFFLLNIVRVLVTKMRETHEAESHMYLKAVKATMILVPLLGIQFVVFP
WRPSNKMLGKIYDYVMHSLIHFQGFFVATIYCFCNNEVQTTVKRQWAQFKIQWNQRWGRR
PSNRSARAAAAAAEAGDIPIYICHQELRNEPANNQGEESAEIIPLNIIEQESSA
You can simplify this a bit:
while (<IN>) {
next unless m/^\s/;
s/\s+//g;
print;
}
You want the lines that begin with whitespace, so immediately skip those that don't. Said another way, quickly reject things you don't want, which is different than accepting things you do want. This means that everything after the next knows it's dealing with a good line. Now the if disappears.
You don't need to get a capture ($1) to get the interesting text because the only other text in the line is the leading whitespace. That leading whitespace disappears when you remove all the whitespace. This gets rid of the if and the extra variable.
Finally, print what's left. Without an argument, print uses the value in the topic variable $_.
Now that's much more manageable. You escape that scoping issue with if causing the extra output because there's no scope to worry about.
I have the following file:
#TWEETY:150:000000000-ACFKE:1:2104:27858:17965
AAATTAGCAAAAAACAATAACAAAACTGGGAAAATGCAATTTAACAACGAAAATTTTCCGAGAACTTGAAAGCGTACGAAAACGATACGCTCC
+
D1FFFB11FDG00EE0FFFA1110FAA1F/ABA0FGHEGDFEEFGDBGGGGFEHBFDDG/FE/EGH1#GF#F0AEEEEFHGGFEFFCEC/>EE
#TWEETY:150:000000000-ACFKE:1:1105:22044:20029
AAAAAATATTAAAACTACGAATGCATAAATTATTTCGTTCGAAATAAACTCACACTCGTAACATTGAACTACGCGCTCC
+
CCFDDDFGGGGGGGGGGHGGHHHHGHHHHHHHHHHHHHHHGHHGHHHHHHHHHHHHHGHGHGGHHHHHHGHHEGGGGGG
#TWEETY:150:000000000-ACFKE:1:2113:14793:7182
TATATAAAGCGAGAGTAGAAACTTTTTAATTGACGCGGCGAGAAAGTATATAGCAACAAGCGAGCACCCGCTCC
+
BBFFFFFGGGGFFGGFGHHHHHHHHHHHHHHHHHGGAEEEAFGGGHHFEGHHGHHHHHGHHGGGGFHHGG?EEG
#TWEETY:150:000000000-ACFKE:1:2109:5013:22093
AAAAAAATAATTCATATCGCCATATCGACTGACAGATAATCTATCTATAATCATAACTTTTCCCTCGCTCC
+
DAFAADDGF1EAGG3EG3A00ECGDFFAEGFCHHCAGHBGEAGBFDEDGGHBGHGFGHHFHHHBDG?/FA/
#TWEETY:150:000000000-ACFKE:1:2106:25318:19875
+
CCCCCCCCCCCCGGGGGGGGGGGGGGGGGGGGGGGGFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF
The lines are in groups of four (each time there is a name, starting with #TWEETY, a string of letters, a + character, and another string of letters).
The second and fourth lines should have the same number of characters.
But there are cases where the second line is empty, as in the last four lines.
In these cases, I would like to get rid of the whole block (the previous line before the empty line and the next two lines).
I have just started perl and have been trying to write a script for my problem, but am having a hard time. Does anyone have some feedback?
Thanks!
Keep an array buffer of the last four lines. When it's full, check the second line, print the lines or not, empty the buffer, repeat.
#!/usr/bin/perl
use warnings;
use strict;
my #buffer;
sub output {
print #buffer unless 1 == length $buffer[1];
#buffer = ();
}
while (<>) {
if (4 == #buffer) {
output();
}
push #buffer, $_;
}
output(); # Don't forget to process the last four lines.
Yes. Start with looking at $/ and set it so you can work on a chunk at a time. I would suggest you can treat # as a record separator in your example.
Then iterate your records using a while loop. E.g. while ( <> ) {
Use split on \n to turn the current chunk into an array of lines.
Perform your test on the appropriate lines, and either print - or not - depending on whether it passed.
If you get stuck with that, then I'm sure a specific question including your code and where you're having problems will be well received here.
If you chunk the data correctly, this becomes almost trivial.
#!/usr/bin/perl
use strict;
use warnings;
# Use '#TWEETY' as the record separator to make it
# easy to chunk the data.
local $/ = '#TWEETY';
while (<DATA>) {
# The first entry will be empty (as the separator
# is the first thing in the file). Skip that record.
next unless /\S/;
# Skip any records with two consecutive newlines
# (as they will be the ones with the empty line 2)
next if /\n\n/;
# Print the remaining records
# (with $/ stuck back on the front)
print "$/$_";
}
__DATA__
#TWEETY:150:000000000-ACFKE:1:2104:27858:17965
AAATTAGCAAAAAACAATAACAAAACTGGGAAAATGCAATTTAACAACGAAAATTTTCCGAGAACTTGAAAGCGTACGAAAACGATACGCTCC
+
D1FFFB11FDG00EE0FFFA1110FAA1F/ABA0FGHEGDFEEFGDBGGGGFEHBFDDG/FE/EGH1#GF#F0AEEEEFHGGFEFFCEC/>EE
#TWEETY:150:000000000-ACFKE:1:1105:22044:20029
AAAAAATATTAAAACTACGAATGCATAAATTATTTCGTTCGAAATAAACTCACACTCGTAACATTGAACTACGCGCTCC
+
CCFDDDFGGGGGGGGGGHGGHHHHGHHHHHHHHHHHHHHHGHHGHHHHHHHHHHHHHGHGHGGHHHHHHGHHEGGGGGG
#TWEETY:150:000000000-ACFKE:1:2113:14793:7182
TATATAAAGCGAGAGTAGAAACTTTTTAATTGACGCGGCGAGAAAGTATATAGCAACAAGCGAGCACCCGCTCC
+
BBFFFFFGGGGFFGGFGHHHHHHHHHHHHHHHHHGGAEEEAFGGGHHFEGHHGHHHHHGHHGGGGFHHGG?EEG
#TWEETY:150:000000000-ACFKE:1:2109:5013:22093
AAAAAAATAATTCATATCGCCATATCGACTGACAGATAATCTATCTATAATCATAACTTTTCCCTCGCTCC
+
DAFAADDGF1EAGG3EG3A00ECGDFFAEGFCHHCAGHBGEAGBFDEDGGHBGHGFGHHFHHHBDG?/FA/
#TWEETY:150:000000000-ACFKE:1:2106:25318:19875
+
CCCCCCCCCCCCGGGGGGGGGGGGGGGGGGGGGGGGFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF
Thanks everyone for the feedback!
It was all really useful. Thanks to your suggestions, I explored all the options and learned the unless statement.
The easiest solution given my existing code, was just to add an unless statement at the end.
### Write to output, but remove non-desired Gs
open OUT, ">$outfile";
my #accorder = #{$store0{"accorder"}};
foreach my $acc (#accorder){
# retrieve seq(2nd line) and qual(4th line)
my $seq = $store0{$acc}{"seq"};
my $qual = $store0{$acc}{"qual"};
# clean out polyG at end
$seq =~ s/G{3,}.{0,1}$//;
my $lenseq = length($seq);
my $lenqual = length($qual);
my $startqual = $lenqual - $lenseq;
$qual = substr($qual, 0, $lenseq);
#the above was in order to remove multiple G characters at the end of the
#second line, which is what led to empty lines (lines that were made up of
#only Gs got cut out)
# print to output, unless sequence has become empty
unless($lenseq == 0){ #this is the unless statement I added
print OUT "\#$acc\n$seq\n+\n$qual\n";
}
}
close(OUT);
I am dealing with very large amounts of data. Every now and then there is a slip up. I want to identify each row with an error, under a condition of my choice. With that I want the row number along with the line number of each erroneous row. I will be running this script on a handful of files and I will want to output the report to one.
So here is my example data:
File_source,ID,Name,Number,Date,Last_name
1.csv,1,Jim,9876,2014-08-14,Johnson
1.csv,2,Jim,9876,2014-08-14,smith
1.csv,3,Jim,9876,2014-08-14,williams
1.csv,4,Jim,9876,not_a_date,jones
1.csv,5,Jim,9876,2014-08-14,dean
1.csv,6,Jim,9876,2014-08-14,Ruzyck
Desired output:
Row#5,4.csv,4,Jim,9876,not_a_date,jones (this is an erroneous row)
The condition I have chosen is print to output if anything in the date field is not a date.
As you can see, my desired output contains the line number where the error occurred, along with the data itself.
After I have my output that shows the lines within each file that are in error, I want to grab that line from the untouched original CSV file to redo (both modified and original files contain the same amount of rows). After I have a file of these redone rows, I can omit and clean up where needed to prevent interruption of an import.
Folder structure will contain:
Modified: 4.txt
Original: 4.csv
I have something started here, written in Perl, which by the logic will at least return the rows I need. However I believe my syntax is a little off and I do not know how to plug in the other subroutines.
Code:
$count = 1;
while (<>) {
unless ($F[4] =~ /\d+[-]\d+[-]\d+/)
print "Row#" . $count++ . "," . "$_";
}
The code above is supposed to give me my erroneous rows, but to be able to extract them from the originals is beyond me. The above code also contains some syntax errors.
This will do as you ask.
Please be certain that none of the fields in the data can ever contain a comma , otherwise you will need to use Text::CSV to process it instead of just a simple split.
use strict;
use warnings;
use 5.010;
use autodie;
open my $fh, '<', 'example.csv';
<$fh>; # Skip header
while (<$fh>) {
my #fields = split /,/;
if( $fields[4] !~ /^\d{4}-\d{2}-\d{2}$/ ) {
print "Row#$.,$_";
}
}
output
Row#5,4.csv,4,Jim,9876,not_a_date,jones
Update
If you want to process a number of files then you need this instead.
The close ARGV at the end of the loop is there so that the line counter $. is reset to
1 at the start of each file. Without it it just continues from 1 upwards across all the files.
You would run this like
rob#Samurai-U:~$ perl findbad.pl *.csv
or you could list the files individually, separated by spaces.
For the test I have created files 1.csv and 2.csv which are identical to your example data except that the first field of each line is the name of the file containing the data.
You may not want the line in the output that announces each file name, in which case you should replace the entire first if block with just next if $. == 1.
use strict;
use warnings;
#ARGV = map { glob qq{"$_"} } #ARGV; # For Windows
while (<>) {
if ($. == 1) {
print "\n\nFile: $ARGV\n\n";
next;
}
my #fields = split /,/;
unless ( $fields[4] =~ /^\d{4}-\d{2}-\d{2}$/ ) {
printf "Row#%d,%s", $., $_;
}
close ARGV if eof ARGV;
}
output
File: 1.csv
Row#5,1.csv,4,Jim,9876,not_a_date,jones
File: 2.csv
Row#5,2.csv,4,Jim,9876,not_a_date,jones
I am having quite a bit of trouble with a Perl script I am writing. I want to compare an element of an array to a variable I have to see if they are true. For some reason I cannot seem to get the comparison operation to work correctly. It will either evaluate at true all the time (even when outputting both strings clearly shows they are not the same), or it will always be false and never evaluate (even if they are the same). I have found an example of just this kind of comparison operation on another website, but when I use it it doesn't work. Am I missing something? Is the variable type I take from the file not a string? (Can't be an integer as far as I can tell as it is an IP address).
$ipaddress = '192.43.2.130'
if ($address[0] == ' ')
{
open (FH, "serverips.txt") or die "Crossroads could not find a list of backend servers";
#address = <FH>;
close(FH);
print $address[0];
print $address[1];
}
for ($i = 0; $i < #address; $i++)
{
print "hello";
if ($address[$i] eq $ipaddress)
{print $address[$i];
$file = "server_$i";
print "I got here first";
goto SENDING;}
}
SENDING:
print " I am here";
I am pretty weak in Perl, so forgive me for any rookie mistakes/assumptions I may have made in my very meager bit of code. Thank you for you time.
if ($address[0] == ' ')
{
open (FH, "serverips.txt") or die "Crossroads could not find a list of backend servers";
#address = <FH>;
close(FH);
You have several issues with this code here. First you should use strict because it would tell you that #address is being used before it's defined and you're also using numeric comparison on a string.
Secondly you aren't creating an array of the address in the file. You need to loop through the lines of the file to add each address:
my #address = ();
while( my $addr = <FH> ) {
chomp($addr); # removes the newline character
push(#address, $addr);
}
However you really don't need to push into an array at all. Just loop through the file and find the IP. Also don't use goto. That's what last is for.
while( my $addr = <FH> ) {
chomp($addr);
if( $addr eq $ipaddress ) {
$file = "server_$i";
print $addr,"\n";
print "I got here first"; # not sure what this means
last; # breaks out of the loop
}
}
When you're reading in from a file like that, you should use chomp() when doing a comparison with that line. When you do:
print $address[0];
print $address[1];
The output is on two separate lines, even though you haven't explicitly printed a newline. That's because $address[$i] contains a newline at the end. chomp removes this.
if ($address[$i] eq $ipaddress)
could read
my $currentIP = $address[$i];
chomp($currentIP);
if ($currentIP eq $ipaddress)
Once you're familiar with chomp, you could even use:
chomp(my $currentIP = $address[$i]);
if ($currentIP eq $ipaddress)
Also, please replace the goto with a last statement. That's perl's equivalent of C's break.
Also, from your comment on Jack's answer:
Here's some code you can use for finding how long it's been since a file was modified:
my $secondsSinceUpdate = time() - stat('filename.txt')->mtime;
You probably are having an issue with newlines. Try using chomp($address[$i]).
First of all, please don't use goto. Every time you use goto, the baby Jesus cries while killing a kitten.
Secondly, your code is a bit confusing in that you seem to be populating #address after starting the if($address[0] == '') statement (not to mention that that if should be if($address[0] eq '')).
If you're trying to compare each element of #address with $ipaddress for equality, you can do something like the following
Note: This code assumes that you've populated #address.
my $num_matches=0;
foreach(#address)
{
$num_matches++ if $_ eq $ipaddress;
}
if($num_matches)
{
#You've got a match! Do something.
}
else
{
#You don't have any matches. This may or may not be bad. Do something else.
}
Alternatively, you can use the grep operator to get any and all matches from #address:
my #matches=grep{$_ eq $ipaddress}#address;
if(#matches)
{
#You've got matches.
}
else
{
#Sorry, no matches.
}
Finally, if you're using a version of Perl that is 5.10 or higher, you can use the smart match operator (ie ~~):
if($ipaddress~~#address)
{
#You've got a match!
}
else
{
#Nope, no matches.
}
When you read from a file like that you include the end-of-line character (generally \n) in each element. Use chomp #address; to get rid of it.
Also, use last; to exit the loop; goto is practically never needed.
Here's a rather idiomatic rewrite of your code. I'm excluding some of your logic that you might need, but isn't clear why:
$ipaddress = '192.43.2.130'
open (FH, "serverips.txt") or die "Crossroads could not find a list of backend servers";
while (<FH>) { # loop over the file, using the default input space
chomp; # remove end-of-line
last if ($_ eq $ipaddress); # a RE could easily be used here also, but keep the exact match
}
close(FH);
$file = "server_$."; # $. is the line number - it's not necessary to keep track yourself
print "The file is $file\n";
Some people dislike using perl's implicit variables (like $_ and $.) but they're not that hard to keep track of. perldoc perlvar lists all these variables and explains their usage.
Regarding the exact match vs. "RE" (regular expression, or regexp - see perldoc perlre for lots of gory details) -- the syntax for testing a RE against the default input space ($_) is very simple. Instead of
last if ($_ eq $ipaddress);
you could use
last if (/$ipaddress/);
Although treating an ip address as a regular expression (where . has a special meaning) is probably not a good idea.
I'm using \D to not display digits but why the digits are being displayed using perl regular expressions?
Here's the content of the text2.tx file
1. Hello Brue this is a test.
2. Hello Lisa this is a test.
This is a test 1.
This is a test 2.
Here is the perl program.
#!/usr/bin/perl
use strict;
use warnings;
open READFILE,"<", "test2.txt" or die "Unable to open file";
while(<READFILE>)
{
if(/\D/)
{
print;
}
}
/\D/ just checks that the line has at least one non-digit character (including the newline...). Can you explain what you wanted to check? What output you were expecting?
If you want to only print lines that don't have a digit, you want to do:
if ( ! /\d/ )
(does the line not have a digit), not
if ( /\D/ )
(does the line have a non-digit).
Lets take a look at what is going on behind the scenes. Your while loop is equivalent to:
while(defined($_ = <READFILE>))
{
if($_ =~ /\D/)
{
print $_;
}
}
So, you are checking if the line contains a non-digit character (which it does) and then printing that line.
If you want to print Hello Brue this is a test. instead of 1. Hello Brue this is a test., then you would have to use something like:
while(<READFILE>) {
s/^\d+\. //;
print;
}
Also, it would make for more readable code if you used a variable rather than $_.
What you want is to reject lines that have a digit rather than match lines that have a non-digit (as you're doing)
while (<READFILE>) {
print unless /\d/;
}
This will print each line unless it has a digit on it.