Hi guys so I have been trying to use PERL to print only the headers (the entire >gi line) of protein sequences that start with "MAD" or "MAN" (the first 3 aa) from a FASTA file. But I couldn't figure out which part went wrong.
Thanks in advance!
#!usr/bin/perl
use strict;
my $in_file = $ARGV[0];
open( my $FH_IN, "<", $in_file ); ###open to fileholder
my #lines = <$FH_IN>;
chomp #lines;
my $index = 0;
foreach my $line (#lines) {
$index++;
if ( substr( $line, 0, 3 ) eq "MAD" or substr( $line, 0, 3 ) eq "MAN" ) {
print "#lines [$index-1]\n\n";
} else {
next;
}
}
This is a short part of the FASTA file, the header of the first seq is what I am looking for
>gi|16128078|ref|NP_414627.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate:meso-diaminopimelate ligase [Escherichia coli str. K-12 substr. MG1655] MADRNLRDLLAPWVPDAPSRALREMTLDSRVAAAGDLFVAVVGHQADGRRYIPQAIAQGVAAIIAEAKDE ATDGEIREMHGVPVIYLSQLNERLSALAGRFYHEPSDNLRLVGVTGTNGKTTTTQLLAQWSQLLGEISAV MGTVGNGLLGKVIPTENTTGSAVDVQHELAGLVDQGATFCAMEVSSHGLVQHRVAALKFAASVFTNLSRD HLDYHGDMEHYEAAKWLLYSEHHCGQAIINADDEVGRRWLAKLPDAVAVSMEDHINPNCHGRWLKATEVN
Your print statement is buggy. Should probably be:
print "$lines[$index-1]\n\n";
However, it's typically better to just process a file line by line unless there is a specific reason you need to slurp the entire thing:
#!usr/bin/perl
use strict;
use warnings;
use autodie;
my $file = shift;
#open my $fh, "<", $in_file;
my $fh = \*DATA;
while (<$fh>) {
print if /^>/ && <$fh> =~ /^MA[DN]/;
}
__DATA__
>gi|16128078|ref|NP_414627.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate:meso-diaminopimelate ligase [Escherichia coli str. K-12 substr. MG1655]
MADRNLRDLLAPWVPDAPSRALREMTLDSRVAAAGDLFVAVVGHQADGRRYIPQAIAQGVAAIIAEAKDE
ATDGEIREMHGVPVIYLSQLNERLSALAGRFYHEPSDNLRLVGVTGTNGKTTTTQLLAQWSQLLGEISAV
MGTVGNGLLGKVIPTENTTGSAVDVQHELAGLVDQGATFCAMEVSSHGLVQHRVAALKFAASVFTNLSRD
HLDYHGDMEHYEAAKWLLYSEHHCGQAIINADDEVGRRWLAKLPDAVAVSMEDHINPNCHGRWLKATEVN
–
Outputs:
>gi|16128078|ref|NP_414627.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate:meso-diaminopimelate ligase [Escherichia coli str. K-12 substr. MG1655]
Since you want to know how to improve your code, here is a commented version of your program with some suggestions on how you could change it.
#!/usr/bin/perl
use strict;
You should also add the use warnings pragma, which enables warnings (as you might expect).
my $in_file = $ARGV[0];
It's a good idea to check that $ARGV[0] is defined, and to give an appropriate error message if it isn't, e.g.
my $in_file = $ARGV[0] or die "Please supply the name of the FASTA file to process";
If $ARGV[0] is not defined, Perl executes the die statement.
open( my $FH_IN, "<", $in_file ); # open to fileholder
You should check that the script is able to open the input file; you can use a similar structure to the previous statement, by adding a die statement:
open( my $FH_IN, "<", $in_file ) or die "Could not open $in_file: $!";
The special variable $! holds the error message as to why the file could not be opened (e.g. it doesn't exist, no permission to read it, etc.).
my #lines = <$FH_IN>;
chomp #lines;
my $index = 0;
foreach my $line (#lines) {
$index++;
if ( substr( $line, 0, 3 ) eq "MAD" or substr( $line, 0, 3 ) eq "MAN" ) {
print "#lines [$index-1]\n\n";
This is the problem point in the script. Firstly, the correct way to access an item in the array is using $lines[$index-1]. Secondly, the first item in an array is at index 0, so line 1 of the file will be at position 0 in #lines, line 4 at position 3, etc. Because you've already incremented the index, you're printing the line after the header line. The problem can easily be fixed by incrementing $index at the end of the loop.
}
else {
next;
}
Using next isn't really necessary here because there is no code following the else statement, so there's nothing to gain from telling Perl to skip the rest of the loop.
The fixed code would look like this:
#!/usr/bin/perl
use warnings;
use strict;
my $in_file = $ARGV[0] or die "Please supply the name of the FASTA file to be processed";
open( my $FH_IN, "<", $in_file ) or die "Could not open $in_file: $!";
my #lines = <$FH_IN>;
chomp #lines;
my $index = 0;
foreach my $line (#lines) {
if ( substr( $line, 0, 3 ) eq "MAD" or substr( $line, 0, 3 ) eq "MAN" ) {
print "$lines[$index-1]\n\n";
}
$index++;
}
I hope that is helpful and clear!
Related
I'm trying to build a primary key into a new file from an original File which has the following structure (tbl_20180615.txt):
573103150033,0664,54,MSS02VEN*',INT,zxzc,,,,,
573103150033,0665,54,MSS02VEN,INT,zxzc,,,,,
573103150080,0659,29,MSS05ARA',INT,zxzc,,,,,
573103150080,0660,29,MSS05ARA ,INT,zxzc,,,,,
573103154377,1240,72,MSSTRI01,INT,zxzc,,,,,
573103154377,1240,72,MSSTRI01,INT,zxzc,,,,,
I launch my perl Verify.pl then I send the arguments, the first one is the number of columns to build the primary key in the new file, after I have to send the name of file (original file).
(Verify.pl)
#!/usr/bin/perl
use strict;
use warnings;
my $n1 = $ARGV[0];
my $name = $ARGV[1];
$n1 =~ s/"//g;
my $n2 = $n1 + 1;
my %seen;
my ( $file3 ) = qw(log.txt);
open my $fh3, '>', $file3 or die "Can't open $file3: $!";
print "Loading file ...\n";
open( my $file, "<", "$name" ) || die "Can't read file somefile.txt: $!";
while ( <$file> ) {
chomp;
my #rec = split( /,/, $_, $n2 ); #$n2 sirve para armar la primary key, hacer le split en los campos deseados
for ( my $i = 0; $i < $n1; $i++ ) {
print $fh3 "#rec[$i],";
}
print $fh3 "\n";
}
close( $file );
print "Done!\n";
#########to check duplicates
my ($file4) = qw(log.txt);
print "Checking duplicates records...\n\n";
open (my $file4, "<", "log.txt") || die "Can't read file log.txt: $!";
while ( <$file4> ) {
print if $seen{$_}++;
}
close($file4);
if I send the following instruction
perl Verify.pl 2 tbl_20180615.txt
this code build a new file called "log.txt" with the following structure, splitting the original file () into two columns given by the first argument:
(log.txt)
573103150033,0664,
573103150033,0665,
573103150080,0659,
573103150080,0660,
573103154377,1240,
573103154377,1240,
That works ok, but if I want to read the new file log.txt to check duplicates, it doesn't work, but If I comment the lines to generate the file log.txt (listed above) before the line in the code (###############to check duplicates################) launch the next part of the code it works ok, giving me two duplicates lines and looks like this:
(Result in command line)
573103154377,1240
573103154377,1240
How can I solve this issue?
I think this does what you're asking for. It builds a unique list of derived keys before printing any of them, using a hash to check whether a key has already been generated
Note that I have assigned values to #ARGV to emulate input values. You must remove that statement before running the program with input from the command line
#!/usr/bin/perl
use strict;
use warnings;
use autodie; # Handle bad IO statuses automatically
local #ARGV = qw/ 2 tbl_20180615.txt /; # For testing only
tr/"//d for #ARGV; # "
my ($key_fields, $input_file) = #ARGV;
my $output_file = 'log.txt';
my (#keys, %seen);
print "Loading input ... ";
open my $in_fh, '<', $input_file;
while ( <$in_fh> ) {
chomp;
my #rec = split /,/;
my $key = join ',', #rec[0..$key_fields-1];
push #keys, $key unless $seen{$key}++;
}
print "Done\n";
open my $out_fh, '>', $output_file;
print $out_fh "$_\n" for #keys;
close $out_fh;
output log.txt
573103150033,0664
573103150033,0665
573103150080,0659
573103150080,0660
573103154377,1240
I am trying to send a variable that is defined in an if statement $abc to a new file. The code seems correct but, I know that it is not working because the file is not being created.
Data File Sample:
bos,control,x1,x2,29AUG2016,y1,y2,76.4
bos,control,x2,x3,30AUG2016,y2,y3,78.9
bos,control,x3,x4,01SEP2016,y3,y4,72.5
bos,control,x4,x5,02SEP2016,y4,y5,80.5
Perl Code:
#!/usr/bin/perl
use strict;
use warnings 'all';
use POSIX qw(strftime); #Pull in date
my $currdate = strftime( "%Y%m%d", localtime ); #Date in YYYYMMDD format
my $modded = strftime( "%d%b%Y", localtime ); #Date in DDMONYYYY format
my $newdate = uc $modded; #converts lowercase to uppercase
my $filename = '/home/.../.../text_file'; #Define full file path before opening
open(FILE, '<', $filename) or die "Uh, where's the file again?\n"; #Open file else give up and relay snarky error
while(<FILE>) #Open While Loop
{
chomp;
my #fields = split(',' , $_); #Identify columns
my $site = $fields[0];
my $var1 = $fields[1];
my $var2 = $fields[4];
my $var3 = $fields[7];
my $abc = print "$var1,$var2,$var3\n" if ($var1 =~ "control" && $var2 =~ "$newdate");
open my $abc, '>', '/home/.../.../newfile.txt';
close $abc;
}
close FILE;
In your code you have a few odd things that are likely mistakes.
my $abc = print "$var1,$var2,$var3\n" if ($var1 =~ "c01" && $var2 =~ "$newdate");
print will return success, which it does as 1. So you will print out the string to STDOUT, and then assign 1 to a new lexical variable $abc. $abc is now 1.
All of that only happens if that condition is met. Don't do conditional assignments. The behavior for this is undefined. So if the condition is false, your $abc might be undef. Or something else. Who knows?
open my $abc, '>', '/home/.../.../newfile.txt';
close $abc;
You are opening a new filehandle called $abc. The my will redeclare it. That's a warning that you would get if you had use warnings in your code. It also overwrites your old $abc with a new file handle object.
You don't write anything to the file
... are weird foldernames, but that's probably just obfuscation for your example
I think what you actually want to do is this:
use strict;
use warnings 'all';
# ...
open my $fh, '<', $filename or die $!;
while ( my $line = <$fh> ) {
chomp $line;
my #fields = split( ',', $line );
my $site = $fields[0];
my $var1 = $fields[1];
my $var2 = $fields[4];
my $var3 = $fields[7];
open my $fh_out, '>', '/home/.../.../newfile.txt';
print $fh_out "$var1,$var2,$var3\n" if ( $var1 =~ "c01" && $var2 =~ "$newdate" );
close $fh_out;
}
close $fh;
You don't need the $abc variable in between at all. You can just print to your new file handle $fh_out that's open for writing.
Note that you will overwrite the newfile.txt file every time you have a match in a line inside $filename.
Your current code:
Prints the string
Assigns the result of printing it to a variable
Immediately overwrites that variable with a file handle (assuming open succeeded)
Closes that file handle without using it
Your logic should look more like this:
if ( $var1 =~ "c01" && $var2 =~ "$newdate" ) {
my $abc = "$var1,$var2,$var3\n"
open (my $file, '>', '/home/.../.../newfile.txt') || die("Could not open file: " . $!);
print $file $abc;
close $file;
}
You have a number of problems with your code. In addition to what others have mentioned
You create a new output file every time you find a matching input line. That will leave the file containing only the last printed string
Your test checks whether the text in the second column contains c01, but all of the lines in your sample input have control in the second column, so nothing will be printed
I'm guessing that you want to test for string equality, in which case you need eq instead of =~ which does a regular expression pattern match
I think it should look something more like this
use strict;
use warnings 'all';
use POSIX 'strftime';
my $currdate = uc strftime '%d%b%Y', localtime;
my ($input, $output) = qw/ data.txt newfile.txt /;
open my $fh, '<', $input or die qq{Unable to open "$input" for input: $!};
open my $out_fh, '>', $output or die qq{Unable to open "$output" for output: $!};
while ( <$fh> ) {
chomp;
my #fields = split /,/;
my ($site, $var1, $var2, $var3) = #fields[0,1,4,7];
next unless $var1 eq 'c01' and $var2 eq $currdate;
print $out_fh "$var1,$var2,$var3\n";
}
close $out_fh or die $!;
I want to add random string to existing identifier line in fasta file.
So I get:
MMETSP0259|AmphidiniumcarteCMP1314aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Then the sequence on the next lines as normal. I am have problem with i think in the format output. This is what I get:
MMETSP0259|AmphidiniumCMP1314aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
CTTCATCGCACATGGATAACTGTGTACCTGACTaaaaaaaaaaaaaaaaaaaaaaaaaaaaaab
TCTGGGAAAGGTTGCTATCATGAGTCATAGAATaaaaaaaaaaaaaaaaaaaaaaaaaaaaaac
It's added to every line. (I altered length to fit here.) I want just to add to the identifier line.
This is what i have so far:
use strict;
use warnings;
my $currentId = "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa";
my $header_line;
my $seq;
my $uniqueID;
open (my $fh,"$ARGV[0]") or die "Failed to open file: $!\n";
open (my $out_fh, ">$ARGV[0]_longer_ID_MMETSP.fasta");
while( <$fh> ){
if ($_ =~ m/^(\S+)\s+(.*)/) {
$header_line = $1;
$seq = $2;
$uniqueID = $currentId++;
print $out_fh "$header_line$uniqueID\n$seq";
} # if
} # while
close $fh;
close $out_fh;
Thanks very much, any ideas will be greatly appreciated.
Your program isn't working because the regex ^(\S+)\s+(.*) matches every line in the input file. For instance, \S+ matches CTTCATCGCACATGGATAACTGTGTACCTGACT; the newline at the end of the line matches \s+; and nothing matches .*.
Here's how I would encode your solution. It simply appends $current_id to the end of any line that contains a pipe | character
use strict;
use warnings;
use 5.010;
use autodie;
my ($filename) = #ARGV;
my $current_id = 'a' x 57;
open my $in_fh, '<', $filename;
open my $out_fh, '>', "${filename}_longer_ID_MMETSP.fasta";
while ( my $line = <$in_fh> ) {
chomp $line;
$line .= $current_id if $line =~ tr/|//;
print $line, "\n";
}
close $out_fh;
output
MMETSP0259|AmphidiniumCMP1314aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
CTTCATCGCACATGGATAACTGTGTACCTGACT
TCTGGGAAAGGTTGCTATCATGAGTCATAGAAT
I am trying to bring a file loop through it and remove any strings that have less than four characters in it and then print the list. I come from a javascript world and perl is brand new to me.
use strict;
use warnings;
sub lessThan4 {
open( FILE, "<names.txt" );
my #LINES = <FILE>;
close( FILE );
open( FILE, ">names.txt" );
foreach my $LINE ( #LINES ) {
print FILE $LINE unless ( $LINE.length() < 4 );
}
close( FILE );
}
use strict;
use warnings;
# automatically throw exception if open() fails
use autodie;
sub lessThan4 {
my #LINES = do {
# modern perl uses lexical, and three arg open
open(my $FILE, "<", "names.txt");
<$FILE>;
};
# remove newlines
chomp(#LINES);
open(my $FILE, ">", "names.txt");
foreach my $LINE ( #LINES ) {
print $FILE "$LINE\n" unless length($LINE) < 4;
# possible alternative to 'unless'
# print $FILE "$LINE\n" if length($LINE) >= 4;
}
close($FILE);
}
You're basically there. I hope you'll find some comments on your code useful.
# Well done for including these. So many new Perl users don't
use strict;
use warnings;
# Perl programs traditionally use all lower-case subroutine names
sub lessThan4 {
# 1/ You should use lexical variables for filehandles
# 2/ You should use the three-argument version of open()
# 3/ You should always check the return value from open()
open( FILE, "<names.txt" );
# Upper-case variable names in Perl are assumed to be global variables.
# This is a lexical variable, so name it using lower case.
my #LINES = <FILE>;
close( FILE );
# Same problems with open() here.
open( FILE, ">names.txt" );
foreach my $LINE ( #LINES ) {
# This is your biggest problem. Perl doesn't yet embrace the idea of
# calling methods to get properties of a variable. You need to call
# length() as a function.
print FILE $LINE unless ( $LINE.length() < 4 );
}
close( FILE );
}
Rewriting to take all that into account, we get the following:
use strict;
use warnings;
sub less_than_4 {
open( my $in_file_h, '<', 'names.txt' ) or die "Can't open file: $!";
my #lines = <$in_file_h>;
close( $in_file_h );
open( my $out_file_h, '>', 'names.txt' ) or die "Can't open file: $!";
foreach my $line ( #lines ) {
# Note: $line will include the newline character, so you might need
# to increase 4 to 5 here
print $out_file_h $line unless length $line < 4;
}
close( $out_file_h );
}
I am trying to bring a file loop through it and remove any strings that have less than four characters in it and then print the list.
I suppose you need to remove strings from the file which are less than 4 chars in length.
#!/usr/bin/perl
use strict;
use warnings;
open ($FH, "<", "names.txt");
my #final_list;
while (my $line = <$FH>) {
map {
length($_) > 4 and push (#final_list, $_) ;
} split (/\s/, $line);
}
print "\nWords with more than 4 chars: #final_list\n";
#Please try this one:
use strict;
use warnings;
my #new;
while(<DATA>)
{
#Push all the values less than 4 characters
push(#new, $_) unless(length($_) > '4');
}
print #new;
__DATA__
Williams
John
Joe
Lee
Albert
Francis
Sun
I am trying to solve below issues.
I have 2 files. Address.txt and File.txt. I want to replace all A/B/C/D (File.txt) with corresponding string value (Read from Address.txt file) using perl script. It's not replacing in my output file. I am getting same content of File.txt.
I tried below codes.
Here is Address.txt file
A,APPLE
B,BAL
C,CAT
D,DOG
E,ELEPHANT
F,FROG
G,GOD
H,HORCE
Here is File.txt
A B C
X Y X
M N O
D E F
F G H
Here is my code :
use strict;
use warnings;
open (MYFILE, 'Address.txt');
foreach (<MYFILE>){
chomp;
my #data_new = split/,/sm;
open INPUTFILE, "<", $ARGV[0] or die $!;
open OUT, '>ariout.txt' or die $!;
my $src = $data_new[0];
my $des = $data_new[1];
while (<INPUTFILE>) {
# print "In while :$src \t$des\n";
$_ =~ s/$src/$des/g;
print OUT $_;
}
close INPUTFILE;
close OUT;
# /usr/bin/perl -p -i -e "s/A/APPLE/g" ARGV[0];
}
close (MYFILE);
If i Write $_ =~ s/A/Apple/g;
Then output file is fine and A is replacing with "Apple". But when dynamically coming it's not getting replaced.
Thanks in advance. I am new in perl scripting language . Correct me if I am wrong any where.
Update 1: I updated below code . It's working fine now. My questions Big O of this algo.
Code :
#!/usr/bin/perl
use warnings;
use strict;
open( my $out_fh, ">", "output.txt" ) || die "Can't open the output file for writing: $!";
open( my $address_fh, "<", "Address.txt" ) || die "Can't open the address file: $!";
my %lookup = map { chomp; split( /,/, $_, 2 ) } <$address_fh>;
open( my $file_fh, "<", "File1.txt" ) || die "Can't open the file.txt file: $!";
while (<$file_fh>) {
my #line = split;
for my $char ( #line ) {
( exists $lookup{$char} ) ? print $out_fh " $lookup{$char} " : print $out_fh " $char ";
}
print $out_fh "\n";
}
Not entirely sure how you want your output formatted. Do you want to keep the rows and columns as is?
I took a similar approach as above but kept the formatting the same as in your 'file.txt' file:
#!/usr/bin/perl
use warnings;
use strict;
open( my $out_fh, ">", "output.txt" ) || die "Can't open the output file for writing: $!";
open( my $address_fh, "<", "address.txt" ) || die "Can't open the address file: $!";
my %lookup = map { chomp; split( /,/, $_, 2 ) } <$address_fh>;
open( my $file_fh, "<", "file.txt" ) || die "Can't open the file.txt file: $!";
while (<$file_fh>) {
my #line = split;
for my $char ( #line ) {
( exists $lookup{$char} ) ? print $out_fh " $lookup{$char} " : print $out_fh " $char ";
}
print $out_fh "\n";
}
That will give you the output:
APPLE BAL CAT
X Y X
M N O
DOG ELEPHANT FROG
FROG GOD HORCE
Here's another option that lets Perl handle the opening and closing of files:
use strict;
use warnings;
my $addresses_txt = pop;
my %hash = map { $1 => $2 if /(.+?),(.+)/ } <>;
push #ARGV, $addresses_txt;
while (<>) {
my #array;
push #array, $hash{$_} // $_ for split;
print "#array\n";
}
Usage: perl File.txt Addresses.txt [>outFile.txt]
The last, optional parameter directs output to a file.
Output on your dataset:
APPLE BAL CAT
X Y X
M N O
DOG ELEPHANT FROG
FROG GOD HORCE
The name of the addresses' file is implicitly popped off of #ARGV for use later. Then, a hash is built, using the key/value pairs in File.txt.
The addresses' file is read, splitting each line into its single elements, and the defined-or (//) operator is used to returned the defined hash item or the single element, which is then pushed onto #array. Finally, the array is interpolated in a print statement.
Hope this helps!
First, here is your existing program, rewritten slightly
open the address file
convert the address file to a hash so that the letters are the keys and the strings the values
open the other file
read in the single line in it
split the line into single letters
use the letters to lookup in the hash
use strict;
use warnings;
open(my $a,"Address.txt")||die $!;
my %address=map {split(/,/) } map {split(' ')} <$a>;
open(my $f,"File.txt")||die $!;
my $list=<$f>;
for my $letter (split(' ',$list)) {
print $address{$letter}."\n" if (exists $address{$letter});
}
to make another file with the substitutions in place alter the loop that processes $list
for my $letter (split(' ',$list)) {
if (exists $address{$letter}) {
push #output, $address{$letter};
}
else {
push #output, $letter;
}
}
open(my $o,">newFile.txt")||die $!;
print $o "#output";
Your problem is that in every iteration of your foreach loop you overwrite any changes made earlier to output file.
My solution:
use strict;
use warnings;
open my $replacements, 'Address.txt' or die $!;
my %r;
foreach (<$replacements>) {
chomp;
my ($k, $v) = split/,/sm;
$r{$k} = $v;
}
my $re = '(' . join('|', keys %r) . ')';
open my $input, "<", $ARGV[0] or die $!;
while (<$input>) {
s/$re/$r{$1}/g;
print;
}
#!/usr/bin/perl -w
# to replace multiple text strings in a file with text from another file
#select text from 1st file, replace in 2nd file
$file1 = 'Address.txt'; $file2 = 'File.txt';
# save the strings by which to replace
%replacement = ();
open IN,"$file1" or die "cant open $file1\n";
while(<IN>)
{chomp $_;
#a = split ',',$_;
$replacement{$a[0]} = $a[1];}
close IN;
open OUT,">replaced_file";
open REPL,"$file2" or die "cant open $file2\n";
while(<REPL>)
{chomp $_;
#a = split ' ',$_; #replaced_data = ();
# replace strings wherever possible
foreach $i(#a)
{if(exists $replacement{$i}) {push #replaced_data,$replacement{$i};}
else {push #replaced_data,$i;}
}
print OUT trim(join " ",#replaced_data),"\n";
}
close REPL; close OUT;
########################################
sub trim
{
my $str = $_[0];
$str=~s/^\s*(.*)/$1/;
$str=~s/\s*$//;
return $str;
}