I learning Perl and I want to create a simple application that gets all my emails and save they to a file, but how I can do this? Thanks.
I used to use the following script to filter SpamAssassin flagged email before switching ISPs:
#!/usr/bin/perl
use strict;
use warnings;
$| = 1;
use constant SEVERITY => 5;
use Mail::POP3Client;
use Term::ReadKey;
my $user = shift;
my $pop = Mail::POP3Client->new(
HOST => '127.0.0.1',
PORT => 9999
);
my $pass = prompt_password();
print "\n";
$pop->User($user);
$pop->Pass($pass);
$pop->Connect or die $pop->Message;
my $count = $pop->Count;
$count >= 0 or die "Failed to get message count.\n";
$count > 0 or die "No messages in mailbox.\n";
my #to_delete;
print "Scanning messages: ";
my $to_delete = 0;
for my $msg_num (1 .. $count) {
my #headers = $pop->Head($msg_num);
for my $h (#headers) {
if($h =~ /^X-Spam-Level: (\*+)/) {
if(SEVERITY <= length $1) {
$to_delete += 1;
$pop->Delete($msg_num);
print "\b*>";
} else {
print "\b->";
}
}
}
}
print "\b ... done\n";
use Lingua::EN::Inflect qw( PL );
if( $to_delete ) {
printf "%d %s will be deleted. Commit: [Y/N]?\n",
$to_delete, PL('message', $to_delete);
$pop->Reset unless yes();
}
$pop->Close;
print "OK\n";
sub yes {
while(my $r = <STDIN>) {
$r = lc substr $r, 0, 1;
return 1 if $r eq 'y';
next unless $r eq 'n';
last;
}
0;
}
sub prompt_password {
print 'Password: ';
ReadMode 2;
my $pass = ReadLine 0;
ReadMode 0;
chomp $pass;
return $pass;
}
It is trivial to change this so it saves messages. See Mail::POP3Client.
POP3 example in Perl
The answer to almost any such question is "Find the right module on CPAN Search".
Most modules come with examples in the documentation and tests.
Good luck, :)
Related
Here is the code:
#!/usr/bin/perl
use warnings;
use strict;
my #user;
my $count = 0;
my #test;
my #last = qx(last);
my #logins;
# Opens the file /etc/passwd and puts the users with an uid
# over 1000 but less that 65000 into an array.
open( my $passwd, "<", "/etc/passwd") or die "/etc/passwd failed to open.\n";
while (my $lines = <$passwd>) {
my #splitarray = split(/\:/, $lines );
if( $splitarray[2] >= 1000 && $splitarray[2] < 65000) {
$user[$count] = $splitarray[0];
#print "$user[$count]\n";
$count++;
}
}
close $passwd;
for my $i (0 .. $#user) {
my $counter = 0;
#logins =qx(last $user[$i]);
for my $j (0 .. $#logins) {
if ($logins[$j] =~ /$user[$i]/) {
$counter++;
}
}
print $user[$i] . ":" . $counter . "\n";
}
And the output from this looks like this:
user1:15
user2:3
user3:6
user4:2
How can i sort this so that it shows the users with the most logins at the top? I tried with a hash but couldn't seem to get it right. Since they are not arrays i don't know how to sort them.
You only have one login counter. In order to sort the users by login count, you will need each user's login count.
my %logins_by_user;
for my $user (#users) {
$logins_by_user{$user} = grep /^\Q$user\E /, `last '$user'`;
}
for my $user (
sort { $logins_by_user{$b} <=> $logins_by_user{$a} || $a cmp $b } #users
) {
print("$user: $logins_by_user{$user}\n");
}
Here's a version which uses a hash and prints the users sorted by login count:
#!/usr/bin/env perl
use strict;
use warnings;
use 5.010;
open(my $passwd, "<", "/etc/passwd") or die "/etc/passwd failed to open.\n";
my %login_count;
while (<$passwd>) {
my #splitarray = split(/\:/);
if ($splitarray[2] >= 1000 && $splitarray[2] < 65000) {
my $user = $splitarray[0];
my #logins = qx(last $user);
# Remove lines that don't mention the user name
#logins = grep /$user/, #logins;
# Using an array in scalar context returns the number of items in the array
$login_count{$user} = #logins;
}
}
close $passwd;
# List users sorted by login count
say "$_ : $login_count{$_}"
for sort { $login_count{$a} cmp $login_count{$b} } keys %login_count;
I am very new at perl and had discovered the solution at:
Perl: Compare Two CSV Files and Print out differences
I have gone through dozens of other solutions and this comes closest, except that instead of finding the differences between 2 CSV files, I want to find where the second CSV file matches the first one in column and row. How could I modify the following script to find the matches in column/row instead of the differences. I am hoping to dissect this code and learn arrays from there, but wanted to find out the solution to this application. Much thanks.
use strict;
my #arr1;
my #arr2;
my $a;
open(FIL,"a.txt") or die("$!");
while (<FIL>)
{chomp; $a=$_; $a =~ s/[\t;, ]*//g; push #arr1, $a if ($a ne '');};
close(FIL);
open(FIL,"b.txt") or die("$!");
while (<FIL>)
{chomp; $a=$_; $a =~ s/[\t;, ]*//g; push #arr2, $a if ($a ne '');};
close(FIL);
my %arr1hash;
my %arr2hash;
my #diffarr;
foreach(#arr1) {$arr1hash{$_} = 1; }
foreach(#arr2) {$arr2hash{$_} = 1; }
foreach $a(#arr1)
{
if (not defined($arr2hash{$a}))
{
push #diffarr, $a;
}
}
foreach $a(#arr2)
{
if (not defined($arr1hash{$a}))
{
push #diffarr, $a;
}
}
print "Diff:\n";
foreach $a(#diffarr)
{
print "$a\n";
}
# You can print to a file instead, by: print FIL "$a\n";
ok, I realize that this was more what I was looking for:
use strict;
use warnings;
use feature qw(say);
use autodie;
use constant {
FILE_1 => "file1.txt",
FILE_2 => "file2.txt",
};
#
# Load Hash #1 with value from File #1
#
my %hash1;
open my $file1_fh, "<", FILE_1;
while ( my $value = <$file1_fh> ) {
chomp $value;
$hash1{$value} = 1;
}
close $file1_fh;
#
# Load Hash #2 with value from File #2
#
my %hash2;
open my $file2_fh, "<", FILE_2;
while ( my $value = <$file2_fh> ) {
chomp $value;
$hash2{$value} = 1;
}
close $file2_fh;
Now I want to search file2's hash to check if there are ANY matches from file1's hash. That is where I am stuck
With new code suggestion, code now looks like this
#!/usr/bin/env perl
use strict;
use warnings;
use feature qw(say);
use autodie;
use constant {
FILE_1 => "masterlist.csv",
FILE_2 => "pastebin.csv",
};
#
# Load Hash #1 with value from File #1
#
my %hash1;
open my $file1_fh, "<", FILE_1;
while ( my $value = <$file1_fh> ) {
chomp $value;
$hash1{$value} = 1;
}
close $file1_fh;
my %hash2;
open my $file2_fh, "<", FILE_2;
while ( my $value = <$file2_fh> ) {
chomp $value;
if ( $hash1{$value} ) {
print "Match found $value\n";
$hash2{$value}++;
}
}
close $file2_fh;
print "Matches found:\n";
foreach my $key ( keys %hash2 ) {
print "$key found $hash2{$key} times\n";
}
I updated one part with split() and it seems to work, but have to test more to confirm if it fits the solution I'm looking for or I have more work to do one it
#
# Load Hash #1 with value from File #1
#
my %hash1;
open my $file1_fh, "<", FILE_1;
while ( my $value = <$file1_fh> ) {
chomp $value;
$hash1{$value} = ( %hash1, (split(/,/, $_))[1,2] );
}
close $file1_fh;
So, with your code there - you've read in 'file1' to a hash.
Why not instead of reading file 2 into a hash, do instead:
my %hash2;
open my $file2_fh, "<", FILE_2;
while ( my $value = <$file2_fh> ) {
chomp $value;
if ( $hash1{$value} ) {
print "Match found $value\n";
$hash2{$value}++;
}
}
close $file2_fh;
print "Matches found:\n";
foreach my $key ( keys %hash2 ) {
print "$key found $hash2{$key} times\n";
}
I think this code identifies every place that a data field in file A matches a data field in file B (at least it does on my limited test data):
use strict;
use warnings;
my #arr1;
my #arr2;
# a.txt -> #arr1
my $file_a_name = "poster_a.txt";
open(FIL,$file_a_name) or die("$!");
my $a_line_counter = 0;
while (my $a_line = <FIL>)
{
$a_line_counter = $a_line_counter + 1;
chomp($a_line);
my #fields = (split /,/,$a_line);
my $num_fields = scalar(#fields);
s{^\s+|\s+$}{}g foreach #fields;
push #arr1, \#fields if ( $num_fields ne 0);
};;
close(FIL);
my $file_b_name = "poster_b.txt";
open(FIL,$file_b_name) or die("$!");
while (my $b_line = <FIL>)
{
chomp($b_line);
my #fields = (split /,/,$b_line);
my $num_fields = scalar(#fields);
s{^\s+|\s+$}{}g foreach #fields;
push #arr2, \#fields if ( $num_fields ne 0)
};
close(FIL);
# b.txt -> #arr2
#print "\n",#arr2, "\n";
my #match_array;
my $file_a_line_ctr = 1;
foreach my $file_a_line_fields (#arr1)
{
my $file_a_column_ctr = 1;
foreach my $file_a_line_field (#{$file_a_line_fields})
{
my $file_b_line_ctr = 1;
foreach my $file_b_line_fields(#arr2)
{
my $file_b_column_ctr = 1;
foreach my $file_b_field (#{$file_b_line_fields})
{
if ( $file_b_field eq $file_a_line_field )
{
my $match_info =
"$file_a_name line $file_a_line_ctr column $file_a_column_ctr" .
" (${file_a_line_field}) matches: " .
"$file_b_name line $file_b_line_ctr column $file_b_column_ctr ";
push(#match_array, $match_info);
print "$match_info \n";
}
$file_b_column_ctr = $file_b_column_ctr + 1;
}
$file_b_line_ctr = $file_b_line_ctr + 1;
}
$file_a_column_ctr = $file_a_column_ctr + 1;
}
$file_a_line_ctr = $file_a_line_ctr + 1;
}
print "there were ", scalar(#match_array)," matches\n";
This is a homework assignment. I am not looking for the "code to make it work" more looking for a point in the right direction on where my logic is wrong.
use strict;
use warnings;
#rot13 sub for passwords
sub rot13{
my $result;
chomp(my $input = <STDIN>);``
# all has to be lower case
my $lower = lc $input;
my $leng = length $lower;
for(my $i = 0; $i < $leng; $i++){
my $temp = substr ($lower,$i,1);
my $con = ord $temp;
if($con >= '55'){
if($con >= '110'){
$con -= 13;
}
else{
$con += 13;
}
}
$result = $result . chr $con;
}
return $result;
};
#opening a file specified by the user for input and reading it
#into an array then closing file.
open FILE, $ARGV[0] or die "cannot open input.txt";
my #input = <FILE>;
close FILE;
my (#username,#password,#name,#uid,#shell,#ssn,#dir,#group,#gid);
my $ui = 100;
foreach(#input){
my ($nam, $ss, $gro) = split ('/', $_);
chomp ($gro);
$nam= lc $nam;
I created a hash so I can use the exists function then using the function and if it does exist go to the next round of the loop. I feel like I am missing something with this.
my %nacheck;
if( exists ($nacheck { '$nam' } )){
next;
}
$nacheck{ "$nam" } = 1;
while (my ($key, $value) = each %nacheck){
print "$key => $value\n";
}
All this works for now but any tips on how to do it better would be appreaciated
my($unf, $unm, $unl) = split (/ /, $nam);
$unf = (substr $unf,0,1);
$unm = (substr $unm,0,1);
$unl = (substr $unl,0,1);
my $un = $unf . $unm . $unl;
if(($gro) eq "faculty"){
push #username, $un;
push #gid, "1010";
push #dir, "/home/faculty/$un";
push #shell, "/bin/tcsh";
}
else{
my $lssn = substr ($ss,7,4);
push #username, $un . $lssn;
push #gid, "505";
push #dir, "/home/student/$un";
push #shell, "/bin/bash";
}
#pushing results onto global arrays to print out later
push #ssn, $ss;
my $pass = rot13;
push #password, $pass;
push #name, $nam;
push #uid, $ui += 1;
}
#printing results
for(my $i = 0; $i < #username; $i++){
print
"$username[$i]:$password[$i]:$uid[$i]:$gid[$i]:$name[$i]:$dir[$i]:$shell[$i]\n";
}
The value of the expression '$nam' is those four characters themselves. The value of the expression "$nam" is whatever the value of the variable $nam is, expressed as a string.
Double quotes allow string interpolation. Single quotes do not; you get exactly what you type.
As you've written it:
my %nacheck;
if( exists ($nacheck { '$nam' } )){
next;
}
$nacheck{ "$nam" } = 1;
the %nacheck is newly created and must be empty. Therefore the exists test fails.
Or have you just shown the definition adjacent to the test for the purpose of the example?
If so, can you show us what your code actually looks like?
Edit: Also, as Charles Engelke noted, you've used single-quotes around a variable '$nam' which is wrong.
I am currently working on a little parser.
i have had very good results with the first script! This was able to run great!
It fetches the data from the page: http://192.68.214.70/km/asps/schulsuche.asp?q=n&a=20
(note 6142 records) - But note - the data are not separated, so the subequent work with the data is a bit difficult. Therefore i have a second script - see below!
Note - friends helped me with the both scripts. I need to introduce myself as a true novice who needs help in migration two in one. So, you see, my Perl-knowlgedge is not so elaborated that i am able to do the migration into one on my own! Any and all help would be great!
The first script: a spider and parser: it spits out the data like this:
lfd. Nr. Schul- nummer Schulname Straße PLZ Ort Telefon Fax Schulart Webseite
1 0401 Mädchenrealschule Marienburg, Abenberg, der Diözese Eichstätt Marienburg 1 91183 Abenberg 09178/509210 Realschulen mrs-marienburg.homepage.t-online.de
2 6581 Volksschule Abenberg (Grundschule) Güssübelstr. 2 91183 Abenberg 09178/215 09178/905060 Volksschulen home.t-online.de/home/vs-abenberg
3 6913 Mittelschule Abenberg Güssübelstr. 2 91183 Abenberg 09178/215 09178/905060 Volksschulen home.t-online.de/home/vs-abenberg
4 0402 Johann-Turmair-Realschule Staatliche Realschule Abensberg Stadionstraße 46 93326 Abensberg 09443/9143-0,12,13 09443/914330 Realschulen www.rs-abensberg.de
But i need to separate the data: with commas or someting like that!
And i have a second script. This part can do the CSV-formate. i want to ombine it with the spider-logic. But first lets have a look at the first script: with the great spider-logic.
see the code that is appropiate:
#!/usr/bin/perl
use strict;
use warnings;
use HTML::TableExtract;
use LWP::Simple;
use Cwd;
use POSIX qw(strftime);
my $te = HTML::TableExtract->new;
my $total_records = 0;
my $suchbegriffe = "e";
my $treffer = 50;
my $range = 0;
my $url_to_process = "http://192.68.214.70/km/asps/schulsuche.asp?q=";
my $processdir = "processing";
my $counter = 50;
my $displaydate = "";
my $percent = 0;
&workDir();
chdir $processdir;
&processURL();
print "\nPress <enter> to continue\n";
<>;
$displaydate = strftime('%Y%m%d%H%M%S', localtime);
open OUTFILE, ">webdata_for_$suchbegriffe\_$displaydate.txt";
&processData();
close OUTFILE;
print "Finished processing $total_records records...\n";
print "Processed data saved to $ENV{HOME}/$processdir/webdata_for_$suchbegriffe\_$displaydate.txt\n";
unlink 'processing.html';
die "\n";
sub processURL() {
print "\nProcessing $url_to_process$suchbegriffe&a=$treffer&s=$range\n";
getstore("$url_to_process$suchbegriffe&a=$treffer&s=$range", 'tempfile.html') or die 'Unable to get page';
while( <tempfile.html> ) {
open( FH, "$_" ) or die;
while( <FH> ) {
if( $_ =~ /^.*?(Treffer <b>)(d+)( - )(d+)(</b> w+ w+ <b>)(d+).*/ ) {
$total_records = $6;
print "Total records to process is $total_records\n";
}
}
close FH;
}
unlink 'tempfile.html';
}
sub processData() {
while ( $range <= $total_records) {
getstore("$url_to_process$suchbegriffe&a=$treffer&s=$range", 'processing.html') or die 'Unable to get page';
$te->parse_file('processing.html');
my ($table) = $te->tables;
for my $row ( $table->rows ) {
cleanup(#$row);
print OUTFILE "#$row\n";
}
$| = 1;
print "Processed records $range to $counter";
print "\r";
$counter = $counter + 50;
$range = $range + 50;
$te = HTML::TableExtract->new;
}
}
sub cleanup() {
for ( #_ ) {
s/s+/ /g;
}
}
sub workDir() {
# Use home directory to process data
chdir or die "$!";
if ( ! -d $processdir ) {
mkdir ("$ENV{HOME}/$processdir", 0755) or die "Cannot make directory $processdir: $!";
}
}
But as this-above script-unfortunatley does not take care for the separators i have had to take care for a method, that does look for separators. In order to get the data (output) separated.
So with the separation i am able to work with the data - and store it in a mysql-table.. or do something else...So here [below] are the bits - that work out the csv-formate Note - i want to put the code below into the code above - to combine the spider-logic of the above mentioned code with the logic of outputting the data in CSV-formate.
where to set in the code Question: can we identify this point to migrate the one into the other... !?
That would be amazing... I hope i could make clear what i have in mind...!? Are we able to use the benefits of the both parts (/scripts ) migrating them into one?
So the question is: where to set in with the CSV-Script into the script (above)
#!/usr/bin/perl
use warnings;
use strict;
use LWP::Simple;
use HTML::TableExtract;
use Text::CSV;
my $html= get 'http://192.68.214.70/km/asps/schulsuche.asp?q=a&a=20';
$html =~ tr/\r//d; # strip carriage returns
$html =~ s/ / /g; # expand spaces
my $te = new HTML::TableExtract();
$te->parse($html);
my #cols = qw(
rownum
number
name
phone
type
website
);
my #fields = qw(
rownum
number
name
street
postal
town
phone
fax
type
website
);
my $csv = Text::CSV->new({ binary => 1 });
foreach my $ts ($te->table_states) {
foreach my $row ($ts->rows) {
# trim leading/trailing whitespace from base fields
s/^\s+//, s/\s+$// for #$row;
# load the fields into the hash using a "hash slice"
my %h;
#h{#cols} = #$row;
# derive some fields from base fields, again using a hash slice
#h{qw/name street postal town/} = split /\n+/, $h{name};
#h{qw/phone fax/} = split /\n+/, $h{phone};
# trim leading/trailing whitespace from derived fields
s/^\s+//, s/\s+$// for #h{qw/name street postal town/};
$csv->combine(#h{#fields});
print $csv->string, "\n";
}
}
The thing is that i have had very good results with the first script! It fetches the data from the page: http://192.68.214.70/km/asps/schulsuche.asp?q=n&a=20
(note 6142 records) - But note - the data are not separated...!
And i have a second script. This part can do the CSV-formate. i want to combine it with the spider-logic.
where is the part to insert? I look forward to any and all help.
if i have to be more precice - just let me know...
Since you have entered a complete script, I'll assume you want critique of the whole thing.
#!/usr/bin/perl
use strict;
use warnings;
use HTML::TableExtract;
use LWP::Simple;
use Cwd;
use POSIX qw(strftime);
my $te = HTML::TableExtract->new;
Since you only use $te in one block, why are you declaring and initializing it in this outer scope? The same question applies to most of your variables -- try to declare them in the innermost scope possible.
my $total_records = 0;
my $suchbegriffe = "e";
my $treffer = 50;
In general, english variable names will enable you to collaborate with far more people than german names. I understand german, so I understand the intent of your code, but most of SO doesn't.
my $range = 0;
my $url_to_process = "http://192.68.214.70/km/asps/schulsuche.asp?q=";
my $processdir = "processing";
my $counter = 50;
my $displaydate = "";
my $percent = 0;
&workDir();
Don't use & to call subs. Just call them with workDir;. It hasn't been necessary to use & since 1994, and it can lead to a nasty gotcha because &callMySub; is a special case which doesn't do what you might think, while callMySub; does the Right Thing.
chdir $processdir;
&processURL();
print "\nPress <enter> to continue\n";
<>;
$displaydate = strftime('%Y%m%d%H%M%S', localtime);
open OUTFILE, ">webdata_for_$suchbegriffe\_$displaydate.txt";
Generally lexical filehandles are preferred these days: open my $outfile, ">file"; Also, you should check for errors from open or use autodie; to make open die on failure.
&processData();
close OUTFILE;
print "Finished processing $total_records records...\n";
print "Processed data saved to $ENV{HOME}/$processdir/webdata_for_$suchbegriffe\_$displaydate.txt\n";
unlink 'processing.html';
die "\n";
sub processURL() {
print "\nProcessing $url_to_process$suchbegriffe&a=$treffer&s=$range\n";
getstore("$url_to_process$suchbegriffe&a=$treffer&s=$range", 'tempfile.html') or die 'Unable to get page';
while( <tempfile.html> ) {
open( FH, "$_" ) or die;
while( <FH> ) {
if( $_ =~ /^.*?(Treffer <b>)(d+)( - )(d+)(</b> w+ w+ <b>)(d+).*/ ) {
$total_records = $6;
print "Total records to process is $total_records\n";
}
}
close FH;
}
unlink 'tempfile.html';
}
sub processData() {
while ( $range <= $total_records) {
getstore("$url_to_process$suchbegriffe&a=$treffer&s=$range", 'processing.html') or die 'Unable to get page';
$te->parse_file('processing.html');
my ($table) = $te->tables;
for my $row ( $table->rows ) {
cleanup(#$row);
print OUTFILE "#$row\n";
This is the line to change if you want to put commas in separating your data. Look at the join function, it can do what you want.
}
$| = 1;
print "Processed records $range to $counter";
print "\r";
$counter = $counter + 50;
$range = $range + 50;
$te = HTML::TableExtract->new;
}
It's very strange to initialize $te at the end of the loop instead of the beginning. It's much more idiomatic to declare and initialize $te at the top of the loop.
}
sub cleanup() {
for ( #_ ) {
s/s+/ /g;
Did you mean s/\s+/ /g;?
}
}
sub workDir() {
# Use home directory to process data
chdir or die "$!";
if ( ! -d $processdir ) {
mkdir ("$ENV{HOME}/$processdir", 0755) or die "Cannot make directory $processdir: $!";
}
}
I haven't commented on your second script; perhaps you should ask it as a separate question.
The following is the script for finding consecutive substrings in strings.
use strict;
use warnings;
my $file="Sample.txt";
open(DAT, $file) || die("Could not open file!");
#worry about these later
#my $regexp1 = "motif1";
#my $regexp2 = "motif2";
#my $regexp3 = "motif3";
#my $regexp4 = "motif4";
my $sequence;
while (my $line = <DAT>) {
if ($line=~ /(HDWFLSFKD)/g){
{
print "its found index location: ",
pos($line), "-", pos($line)+length($1), "\n";
}
if ($line=~ /(HD)/g){
print "motif found and its locations is: \n";
pos($line), "-", pos($line)+length($1), "\n\n";
}
if ($line=~ /(K)/g){
print "motif found and its location is: \n";
pos($line), "-",pos($line)+length($1), "\n\n";
}
if ($line=~ /(DD)/g){
print "motif found and its location is: \n";
pos($line), "-", pos($line)+length($1), "\n\n";
}
}else {
$sequence .= $line;
print "came in else\n";
}
}
It matches substring1 with string and prints out position where substring1 matched. The problem lies in finding the rest of the substrings. For substrings2 it starts again from the beginning of the string (instead of starting from the position where substring1 was found). The problem is that every time it calculates position it starts from the beginning of string instead of starting from the position of the previously found substring. Since substrings are consecutive substring1, substring2, substring3, substring4, their positions have to occur after the previous respectively.
Try this perl program
use strict;
use warnings;
use feature qw'say';
my $file="Sample.txt";
open( my $dat, '<', $file) || die("Could not open file!");
my #regex = qw(
HDWFLSFKD
HD
K
DD
);
my $sequence;
while( my $line = <$dat> ){
chomp $line;
say 'Line: ', $.;
# reset the position of variable $line
# pos is an lvalue subroutine
pos $line = 0;
for my $regex ( #regex ){
$regex = quotemeta $regex;
if( scalar $line =~ / \G (.*?) ($regex) /xg ){
say $regex, ' found at location (', $-[2], '-', $+[2], ')';
if( $1 ){
say " but skipped: \"$1\" at location ($-[1]-$+[1])";
}
}else{
say 'Unable to find ', $regex;
# end loop
last;
}
}
}
I'm not a perl expert but you can use $- and $+ to track index location for last regex match found.
Below is code built on top of your code that explains this.
use strict;
use warnings;
my $file="sample.txt";
open(DAT, $file) || die("Could not open file!");
open (OUTPUTFILE, '>data.txt');
my $sequence;
my $someVar = 0;
my $sequenceNums = 1;
my $motif1 = "(HDWFLSFKD)";
my $motif2 = "(HD)";
my $motif3 = "(K)";
my $motif4 = "(DD)";
while (my $line = <DAT>)
{
$someVar = 0;
print "\nSequence $sequenceNums: $line\n";
print OUTPUTFILE "\nSequence $sequenceNums: $line\n";
if ($line=~ /$motif1/g)
{
&printStuff($sequenceNums, "motif1", $motif1, "$-[0]-$+[0]");
$someVar = 1;
}
if ($line=~ /$motif2/g and $someVar == 1)
{
&printStuff($sequenceNums, "motif2", $motif2, "$-[0]-$+[0]");
$someVar = 2;
}
if ($line=~ /$motif3/g and $someVar == 2)
{
&printStuff($sequenceNums, "motif3", $motif4, "$-[0]-$+[0]");
$someVar = 3;
}
if ($line=~ /$motif4/g and $someVar == 3)
{
&printStuff($sequenceNums, "motif4", $motif4, "$-[0]-$+[0]");
}
else
{
$sequence .= $line;
if ($someVar == 0)
{
&printWrongStuff($sequenceNums, "motif1", $motif1);
}
elsif ($someVar == 1)
{
&printWrongStuff($sequenceNums, "motif2", $motif2);
}
elsif ($someVar == 2)
{
&printWrongStuff($sequenceNums, "motif3", $motif3);
}
elsif ($someVar == 3)
{
&printWrongStuff($sequenceNums, "motif4", $motif4);
}
}
$sequenceNums++;
}
sub printStuff
{
print "Sequence: $_[0] $_[1]: $_[2] index location: $_[3] \n";
print OUTPUTFILE "Sequence: $_[0] $_[1]: $_[2] index location: $_[3]\n";
}
sub printWrongStuff
{
print "Sequence: $_[0] $_[1]: $_[2] was not found\n";
print OUTPUTFILE "Sequence: $_[0] $_[1]: $_[2] was not found\n";
}
close (OUTPUTFILE);
close (DAT);
Sample input:
MLTSHQKKFHDWFLSFKDSNNYNHDSKQNHSIKDDIFNRFNHYIYNDLGIRTIA
MLTSHQKKFSNNYNSKQNHSIKDIFNRFNHYIYNDLGIRTIA
MLTSHQKKFSNNYNSKHDWFLSFKDQNHSIKDIFNRFNHYIYNDL
You really should read
perldoc perlre
perldoc perlreref
perldoc perlretut
You need the special variables #- and #+ if you need the positions. No need to try to compute them yourself.
#!/usr/bin/perl
use strict;
use warnings;
use List::MoreUtils qw( each_array );
my $source = 'AAAA BBCCC DD E FFFFF';
my $pattern = join '\s*', map { "($_+)" } qw( A B C D E F );
if ( $source =~ /$pattern/ ) {
my $it = each_array #-, #+;
$it->(); # discard overall match information;
while ( my ($start, $end) = $it->() ) {
printf "Start: %d - Length: %d\n", $start, $end - $start;
}
}
Start: 0 - Length: 4
Start: 7 - Length: 2
Start: 9 - Length: 3
Start: 15 - Length: 2
Start: 19 - Length: 1
Start: 26 - Length: 5
The result of a construct like
$line=~ /(HD)/g
is a list. Use while to step through the hits.
To match where the last match left off, use \G. perldoc perlre says (but consult your own installation's version's manual first):
The "\G" assertion can be used to
chain global matches (using "m//g"),
as described in "Regexp Quote-Like
Operators" in perlop. It is also
useful when writing "lex"-like
scanners, when you have several
patterns that you want to match
against consequent substrings of your
string, see the previous reference.
The actual location where "\G" will
match can also be influenced by using
"pos()" as an lvalue: see "pos" in
perlfunc. Note that the rule for
zero-length matches is modified
somewhat, in that contents to the left
of "\G" is not counted when
determining the length of the match.
Thus the following will not match
forever:
$str = 'ABC';
pos($str) = 1;
while (/.\G/g) {
print $&;
}